Lineage for d4hr7a3 (4hr7 A:331-446)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817541Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2817548Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2817551Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 2817582Domain d4hr7a3: 4hr7 A:331-446 [222722]
    Other proteins in same PDB: d4hr7a1, d4hr7a2, d4hr7b_, d4hr7c1, d4hr7c2, d4hr7d_, d4hr7e1, d4hr7e2, d4hr7f1, d4hr7f2, d4hr7g_, d4hr7i_
    automated match to d1dv1a1
    complexed with edo, so4

Details for d4hr7a3

PDB Entry: 4hr7 (more details), 2.5 Å

PDB Description: Crystal Structure of Biotin Carboxyl Carrier Protein-Biotin Carboxylase Complex from E.coli
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4hr7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr7a3 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d4hr7a3:

Click to download the PDB-style file with coordinates for d4hr7a3.
(The format of our PDB-style files is described here.)

Timeline for d4hr7a3: