SCOPe 2.08: Domain d4hr3a2: 4hr3 A:254-409

Lineage for d4hr3a2 (4hr3 A:254-409)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries)

8. Domain d4hr3a2: 4hr3 A:254-409 [222717]
   Other proteins in same PDB: d4hr3a1
   automated match to d1egda1
   complexed with fad

Details for d4hr3a2

PDB Entry: 4hr3, 1.8 Å

PDB Description: structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus

PDB Compounds: (A:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4hr3a2:

Sequence; same for both SEQRES and ATOM records:

>d4hr3a2 a.29.3.0 (A:254-409) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gkgfeiaqgrlgpgrvhhamrliglaevalehacrrgldrtafgkplvnlggnreriada
riainqtrllvlhaawlldtvgimgalsavseikvaapnmaqqvidmaiqihgggglsnd
fplaaawvnaralrladgpdevhrgvvarielakya

Timeline for d4hr3a2:

• d4hr3a2 first appeared in SCOPe 2.03
  
• d4hr3a2 appears in SCOPe 2.07