Lineage for d4hr3a1 (4hr3 A:3-253)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451519Species Mycobacterium abscessus [TaxId:561007] [226108] (2 PDB entries)
  8. 1451520Domain d4hr3a1: 4hr3 A:3-253 [222716]
    Other proteins in same PDB: d4hr3a2
    automated match to d1egda2
    complexed with fad

Details for d4hr3a1

PDB Entry: 4hr3 (more details), 1.8 Å

PDB Description: structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus
PDB Compounds: (A:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4hr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr3a1 e.6.1.0 (A:3-253) automated matches {Mycobacterium abscessus [TaxId: 561007]}
fapsaraaeliaavrefidaevmpveravlahhdellgaragttaelwhvppeldslkak
araaglwnlflpdpelggglsnseyaplaeqmgrslfaptvfncnapdsgnmevlhrygs
qeqkevwlepllegdirsafcmtepdvassdatnmaatavvegdevvingrkwwstgvgh
pdckviifmgltdpnahryarhsmvlvpmdtpgitvermlptmgfydepgghgvvsfdnv
rlpadafiagp

SCOPe Domain Coordinates for d4hr3a1:

Click to download the PDB-style file with coordinates for d4hr3a1.
(The format of our PDB-style files is described here.)

Timeline for d4hr3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hr3a2