| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (14 species) not a true protein |
| Species Mycobacterium abscessus [TaxId:561007] [226108] (2 PDB entries) |
| Domain d4hr3a1: 4hr3 A:3-253 [222716] Other proteins in same PDB: d4hr3a2 automated match to d1egda2 complexed with fad |
PDB Entry: 4hr3 (more details), 1.8 Å
SCOPe Domain Sequences for d4hr3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr3a1 e.6.1.0 (A:3-253) automated matches {Mycobacterium abscessus [TaxId: 561007]}
fapsaraaeliaavrefidaevmpveravlahhdellgaragttaelwhvppeldslkak
araaglwnlflpdpelggglsnseyaplaeqmgrslfaptvfncnapdsgnmevlhrygs
qeqkevwlepllegdirsafcmtepdvassdatnmaatavvegdevvingrkwwstgvgh
pdckviifmgltdpnahryarhsmvlvpmdtpgitvermlptmgfydepgghgvvsfdnv
rlpadafiagp
Timeline for d4hr3a1: