SCOPe 2.08: Domain d4hpsa1: 4hps A:1-206

Lineage for d4hpsa1 (4hps A:1-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.0: automated matches [191433] (1 protein)
   not a true family

6. Protein automated matches [190623] (6 species)
   not a true protein

7. Species Xenorhabdus bovienii [TaxId:406818] [193515] (2 PDB entries)

8. Domain d4hpsa1: 4hps A:1-206 [222708]
   Other proteins in same PDB: d4hpsa2, d4hpsb2
   automated match to d3ro0b_
   complexed with cl

Details for d4hpsa1

PDB Entry: 4hps, 1.55 Å

PDB Description: crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 in space group p21

PDB Compounds: (A:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d4hpsa1:

Sequence; same for both SEQRES and ATOM records:

>d4hpsa1 c.56.4.0 (A:1-206) automated matches {Xenorhabdus bovienii [TaxId: 406818]}
mktilvtafdpfggeainpsweaikplqgsqvfganieicqipcifdtslehlyaavdky
qpelvisvgqaggrtnitvervainindaripdnagnqpidtpvivdgpaayfsrlpikt
mvnalntagipasvsqtagtfvcnhvmygllhylaqntpsvrggfihvpylpeqavkdgn
qssmtlmlmtlalkiaietawkntsd

Timeline for d4hpsa1:

• d4hpsa1 first appeared in SCOPe 2.03, called d4hpsa_
  
• d4hpsa1 appears in SCOPe 2.07