Lineage for d4hnzd_ (4hnz D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1439841Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1439842Protein automated matches [190509] (8 species)
    not a true protein
  7. 1439885Species Trypanosoma brucei [TaxId:999953] [224942] (2 PDB entries)
  8. 1439889Domain d4hnzd_: 4hnz D: [222690]
    automated match to d1g3ka_
    complexed with mg

Details for d4hnzd_

PDB Entry: 4hnz (more details), 2.39 Å

PDB Description: Crystal structure of eukaryotic HslV from Trypanosoma brucei
PDB Compounds: (D:) HslVU complex proteolytic subunit, putative

SCOPe Domain Sequences for d4hnzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnzd_ d.153.1.0 (D:) automated matches {Trypanosoma brucei [TaxId: 999953]}
ttilsvrkgdtvvllgdrqvtlgerivakssacklrrinddvvigfagstadaislmekl
enkigefpnqltraavelakewrtdralrrleaslivcsaeetleidgqgnvitpeadgi
vaigsggtfakaaaralidvdgydaekiarkamriatdidvfsnehwdvevleh

SCOPe Domain Coordinates for d4hnzd_:

Click to download the PDB-style file with coordinates for d4hnzd_.
(The format of our PDB-style files is described here.)

Timeline for d4hnzd_: