Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [224942] (2 PDB entries) |
Domain d4hnzb1: 4hnz B:1-173 [222688] Other proteins in same PDB: d4hnza2, d4hnzb2, d4hnzc2, d4hnzd2, d4hnze2, d4hnzf2, d4hnzg2, d4hnzh2, d4hnzi2, d4hnzj2, d4hnzk2, d4hnzl2 automated match to d1g3ka_ complexed with mg |
PDB Entry: 4hnz (more details), 2.39 Å
SCOPe Domain Sequences for d4hnzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnzb1 d.153.1.0 (B:1-173) automated matches {Trypanosoma brucei [TaxId: 999953]} ttilsvrkgdtvvllgdrqvtlgerivakssacklrrinddvvigfagstadaislmekl enkigefpnqltraavelakewrtdralrrleaslivcsaeetleidgqgnvitpeadgi vaigsggtfakaaaralidvdgydaekiarkamriatdidvfsnehwdvevle
Timeline for d4hnzb1: