Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species) elaborated with additional secondary structures; active as dimer |
Species Pseudomonas fluorescens [TaxId:294] [117227] (5 PDB entries) Uniprot Q51793 |
Domain d4hmvb_: 4hmv B: [222684] automated match to d1ty9b_ complexed with fmn, so4, wub |
PDB Entry: 4hmv (more details), 1.45 Å
SCOPe Domain Sequences for d4hmvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hmvb_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]} esltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstrivv iseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakaddaw lkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefwg ngqerlherlrydrsdtgwnvrrlqp
Timeline for d4hmvb_: