SCOPe 2.05: Domain d4hmta_: 4hmt A:

Lineage for d4hmta_ (4hmt A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Pseudomonas fluorescens [TaxId:294] [117227] (5 PDB entries)
   Uniprot Q51793

8. Domain d4hmta_: 4hmt A: [222679]
   automated match to d1ty9b_
   complexed with fmn, nnv, so4

Details for d4hmta_

PDB Entry: 4hmt, 1.42 Å

PDB Description: Crystal structure of PhzG from Pseudomonas fluorescens 2-79 in complex with hexahydrophenazine-1,6-dicarboxylic acid

PDB Compounds: (A:) Phenazine biosynthesis protein phzG

SCOPe Domain Sequences for d4hmta_:

Sequence; same for both SEQRES and ATOM records:

>d4hmta_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]}
sltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstrivvi
seisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakaddawl
krpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefwgn
gqerlherlrydrsdtgwnvrrlqp

Timeline for d4hmta_:

• d4hmta_ first appeared in SCOPe 2.03
  
• d4hmta_ appears in SCOPe 2.04
  
• d4hmta_ appears in SCOPe 2.06
  
• d4hmta_ appears in the current release, SCOPe 2.08