Lineage for d4hmma_ (4hmm A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400466Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1400467Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1400468Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1400529Protein automated matches [191016] (3 species)
    not a true protein
  7. 1400537Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (3 PDB entries)
  8. 1400540Domain d4hmma_: 4hmm A: [222673]
    automated match to d1fo7a_
    complexed with cl, gol, na; mutant

Details for d4hmma_

PDB Entry: 4hmm (more details), 1.5 Å

PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S174N)
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4hmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmma_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqes

SCOPe Domain Coordinates for d4hmma_:

Click to download the PDB-style file with coordinates for d4hmma_.
(The format of our PDB-style files is described here.)

Timeline for d4hmma_: