Lineage for d4hmaa_ (4hma A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2570990Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2570991Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2571012Domain d4hmaa_: 4hma A: [222671]
    automated match to d4h1qb_
    complexed with 0zd, ca, gol, mlt, peg, pgo, zn

Details for d4hmaa_

PDB Entry: 4hma (more details), 1.94 Å

PDB Description: crystal structure of an mmp twin carboxylate based inhibitor lc20 in complex with the mmp-9 catalytic domain
PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d4hmaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmaa_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d4hmaa_:

Click to download the PDB-style file with coordinates for d4hmaa_.
(The format of our PDB-style files is described here.)

Timeline for d4hmaa_: