SCOPe 2.08: Domain d4hmaa_: 4hma A:

Lineage for d4hmaa_ (4hma A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)

8. Domain d4hmaa_: 4hma A: [222671]
   automated match to d4h1qb_
   complexed with 0zd, ca, gol, mlt, peg, pgo, zn

Details for d4hmaa_

PDB Entry: 4hma, 1.94 Å

PDB Description: crystal structure of an mmp twin carboxylate based inhibitor lc20 in complex with the mmp-9 catalytic domain

PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d4hmaa_:

Sequence; same for both SEQRES and ATOM records:

>d4hmaa_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d4hmaa_:

• d4hmaa_ first appeared in SCOPe 2.03
  
• d4hmaa_ appears in SCOPe 2.07