Lineage for d4hlzl2 (4hlz L:110-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753152Domain d4hlzl2: 4hlz L:110-214 [222670]
    Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzb_, d4hlzc1, d4hlzc2, d4hlzd_, d4hlze1, d4hlze2, d4hlzf_, d4hlzg1, d4hlzg2, d4hlzh1, d4hlzi_, d4hlzj1, d4hlzk_, d4hlzl1
    automated match to d1dqdl2
    complexed with edo, nag, so4

Details for d4hlzl2

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (L:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzl2:

Sequence, based on SEQRES records: (download)

>d4hlzl2 b.1.1.2 (L:110-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records): (download)

>d4hlzl2 b.1.1.2 (L:110-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4hlzl2:

Click to download the PDB-style file with coordinates for d4hlzl2.
(The format of our PDB-style files is described here.)

Timeline for d4hlzl2: