Lineage for d4hlzl1 (4hlz L:3-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760981Domain d4hlzl1: 4hlz L:3-109 [222669]
    Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzb_, d4hlzc1, d4hlzc2, d4hlzd_, d4hlze1, d4hlze2, d4hlzf_, d4hlzg1, d4hlzg2, d4hlzh2, d4hlzi_, d4hlzj2, d4hlzk_, d4hlzl2
    automated match to d1dqdl1
    complexed with edo, nag, so4

Details for d4hlzl1

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (L:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlzl1 b.1.1.0 (L:3-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleik

SCOPe Domain Coordinates for d4hlzl1:

Click to download the PDB-style file with coordinates for d4hlzl1.
(The format of our PDB-style files is described here.)

Timeline for d4hlzl1: