SCOPe 2.03: Domain d4hlzj2: 4hlz J:110-214

Lineage for d4hlzj2 (4hlz J:110-214)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
Domain d4hlzj2: 4hlz J:110-214 [222668]
Other proteins in same PDB: d4hlza_, d4hlzc_, d4hlze_, d4hlzh1, d4hlzj1, d4hlzl1
automated match to d1dqdl2
complexed with edo, nag, so4

Details for d4hlzj2

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin

PDB Compounds: (J:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlzj2 b.1.1.2 (J:110-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4hlzj2:

Click to download the PDB-style file with coordinates for d4hlzj2.
(The format of our PDB-style files is described here.)

Timeline for d4hlzj2: