Lineage for d1funh_ (1fun H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10172Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries)
  8. 10193Domain d1funh_: 1fun H: [22266]

Details for d1funh_

PDB Entry: 1fun (more details), 2.85 Å

PDB Description: superoxide dismutase mutant with lys 136 replaced by glu, cys 6 replaced by ala and cys 111 replaced by ser (k136e, c6a, c111s)

SCOP Domain Sequences for d1funh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1funh_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestetgnagsrlacgvigiaq

SCOP Domain Coordinates for d1funh_:

Click to download the PDB-style file with coordinates for d1funh_.
(The format of our PDB-style files is described here.)

Timeline for d1funh_: