Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
Domain d4hlab_: 4hla B: [222657] automated match to d1nh0a_ complexed with 017 |
PDB Entry: 4hla (more details), 1.95 Å
SCOPe Domain Sequences for d4hlab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlab_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d4hlab_: