Lineage for d4hl2b1 (4hl2 B:31-270)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231748Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)
  8. 2231750Domain d4hl2b1: 4hl2 B:31-270 [222655]
    Other proteins in same PDB: d4hl2a2, d4hl2b2
    automated match to d4hkyb_
    complexed with edo, zn, zz7

Details for d4hl2b1

PDB Entry: 4hl2 (more details), 1.05 Å

PDB Description: new delhi metallo-beta-lactamase-1 1.05 a structure complexed with hydrolyzed ampicillin
PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4hl2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hl2b1 d.157.1.0 (B:31-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d4hl2b1:

Click to download the PDB-style file with coordinates for d4hl2b1.
(The format of our PDB-style files is described here.)

Timeline for d4hl2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hl2b2