SCOPe 2.08: Domain d4hkxb1: 4hkx B:1-109

Lineage for d4hkxb1 (4hkx B:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4hkxb1: 4hkx B:1-109 [222650]
   Other proteins in same PDB: d4hkxb2
   automated match to d1aqkl1
   complexed with nag

Details for d4hkxb1

PDB Entry: 4hkx, 2.5 Å

PDB Description: influenza hemagglutinin in complex with ch67 fab

PDB Compounds: (B:) CH67 light chain

SCOPe Domain Sequences for d4hkxb1:

Sequence, based on SEQRES records:

>d4hkxb1 b.1.1.0 (B:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqppsvsvapgqtatitcggnnigrkrvdwfqqkpgqapvlvvyedsdrpsgiper
fsdsnsgttatltisrveagdeadyycqvwdsdsdhvvfgggtkltvlg

Sequence, based on observed residues (ATOM records):

>d4hkxb1 b.1.1.0 (B:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqppsvsvapgqtatitcggnnigrkrvdwfqqkpgqapvlvvyerfsdsnsgtta
tltisrveagdeadyycqvwdsdsdhvvfgggtkltvlg

Timeline for d4hkxb1:

• d4hkxb1 first appeared in SCOPe 2.03
  
• d4hkxb1 appears in SCOPe 2.07