Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d4hk0d2: 4hk0 D:110-210 [222649] Other proteins in same PDB: d4hk0b1, d4hk0d1 automated match to d1aqkl2 |
PDB Entry: 4hk0 (more details), 2.5 Å
SCOPe Domain Sequences for d4hk0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hk0d2 b.1.1.2 (D:110-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4hk0d2: