Lineage for d4hk0d1 (4hk0 D:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757972Domain d4hk0d1: 4hk0 D:1-109 [222648]
    Other proteins in same PDB: d4hk0b2, d4hk0d2
    automated match to d1aqkl1

Details for d4hk0d1

PDB Entry: 4hk0 (more details), 2.5 Å

PDB Description: uca fab (unbound) from ch65-ch67 lineage
PDB Compounds: (D:) UCA light chain

SCOPe Domain Sequences for d4hk0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hk0d1 b.1.1.0 (D:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlg

SCOPe Domain Coordinates for d4hk0d1:

Click to download the PDB-style file with coordinates for d4hk0d1.
(The format of our PDB-style files is described here.)

Timeline for d4hk0d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hk0d2