Lineage for d4hjxa_ (4hjx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860283Protein automated matches [190581] (10 species)
    not a true protein
  7. 2860310Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (20 PDB entries)
  8. 2860343Domain d4hjxa_: 4hjx A: [222644]
    automated match to d4hjrb_
    protein/RNA complex; complexed with f2y

Details for d4hjxa_

PDB Entry: 4hjx (more details), 2.91 Å

PDB Description: crystal structure of f2yrs complexed with f2y
PDB Compounds: (A:) Tyrosine-tRNA ligase

SCOPe Domain Sequences for d4hjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjxa_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d4hjxa_:

Click to download the PDB-style file with coordinates for d4hjxa_.
(The format of our PDB-style files is described here.)

Timeline for d4hjxa_: