SCOPe 2.06: Domain d4hjqa_: 4hjq A:

Lineage for d4hjqa_ (4hjq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (28 PDB entries)

8. Domain d4hjqa_: 4hjq A: [222642]
   automated match to d4grya_
   complexed with po4

Details for d4hjqa_

PDB Entry: 4hjq, 1.8 Å

PDB Description: shp-1 catalytic domain wpd loop closed

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d4hjqa_:

Sequence; same for both SEQRES and ATOM records:

>d4hjqa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkkl

Timeline for d4hjqa_:

• d4hjqa_ first appeared in SCOPe 2.03
  
• d4hjqa_ appears in SCOPe 2.05
  
• d4hjqa_ appears in SCOPe 2.07
  
• d4hjqa_ appears in the current release, SCOPe 2.08