| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
| Protein automated matches [190252] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries) |
| Domain d4hjqa_: 4hjq A: [222642] automated match to d4grya_ complexed with po4 |
PDB Entry: 4hjq (more details), 1.8 Å
SCOPe Domain Sequences for d4hjqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hjqa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkkl
Timeline for d4hjqa_: