Lineage for d4hj2a2 (4hj2 A:81-220)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491627Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
    Uniprot P08263
  8. 1491658Domain d4hj2a2: 4hj2 A:81-220 [222639]
    Other proteins in same PDB: d4hj2a1, d4hj2b1
    automated match to d1agsa1
    complexed with lz6

Details for d4hj2a2

PDB Entry: 4hj2 (more details), 2.1 Å

PDB Description: Crystal Structure Analysis of GSTA1-1 in complex with chlorambucil
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d4hj2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hj2a2 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkif

SCOPe Domain Coordinates for d4hj2a2:

Click to download the PDB-style file with coordinates for d4hj2a2.
(The format of our PDB-style files is described here.)

Timeline for d4hj2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hj2a1