SCOPe 2.08: Domain d4hj2a2: 4hj2 A:81-220

Lineage for d4hj2a2 (4hj2 A:81-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d4hj2a2: 4hj2 A:81-220 [222639]
   Other proteins in same PDB: d4hj2a1, d4hj2b1
   automated match to d1agsa1
   complexed with lz6

Details for d4hj2a2

PDB Entry: 4hj2, 2.1 Å

PDB Description: Crystal Structure Analysis of GSTA1-1 in complex with chlorambucil

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d4hj2a2:

Sequence; same for both SEQRES and ATOM records:

>d4hj2a2 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkif

Timeline for d4hj2a2:

• d4hj2a2 first appeared in SCOPe 2.03
  
• d4hj2a2 appears in SCOPe 2.07