SCOPe 2.03: Domain d4hisb_: 4his B:

Lineage for d4hisb_ (4his B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (183 PDB entries)
   Uniprot P02766 31-143

8. Domain d4hisb_: 4his B: [222637]
   automated match to d1ttra_
   complexed with 3mi; mutant

Details for d4hisb_

PDB Entry: 4his, 1.2 Å

PDB Description: The Structure of V122I Mutant Transthyretin in Complex with Tafamidis

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4hisb_:

Sequence; same for both SEQRES and ATOM records:

>d4hisb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavitn

Timeline for d4hisb_:

• d4hisb_ is new in SCOPe 2.03-stable
  
• d4hisb_ appears in SCOPe 2.04
  
• d4hisb_ appears in the current release, SCOPe 2.08