Lineage for d4hiic1 (4hii C:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756056Domain d4hiic1: 4hii C:2-107 [222630]
    Other proteins in same PDB: d4hiib_, d4hiid_
    automated match to d1boga1

Details for d4hiic1

PDB Entry: 4hii (more details), 2.3 Å

PDB Description: anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose- galactose
PDB Compounds: (C:) Fab 023.102 light chain

SCOPe Domain Sequences for d4hiic1:

Sequence, based on SEQRES records: (download)

>d4hiic1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqltqspatlslspgeratlscrasqsvtnylawyqqkpgqaprlliygasnratgipar
fsgsgsgtdftltisslepedfavyycqqrdnwppdatfgqgtkveik

Sequence, based on observed residues (ATOM records): (download)

>d4hiic1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqltqspatlslspgeratlscraylawyqqkpgqaprlliygasnratgiparfsgsgg
tdftltisslepedfavyycqqrdnwppdatfgqgtkveik

SCOPe Domain Coordinates for d4hiic1:

Click to download the PDB-style file with coordinates for d4hiic1.
(The format of our PDB-style files is described here.)

Timeline for d4hiic1: