SCOPe 2.06: Domain d4hihc2: 4hih C:108-211

Lineage for d4hihc2 (4hih C:108-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4hihc2: 4hih C:108-211 [222627]
   automated match to d1boga2
   complexed with ram

Details for d4hihc2

PDB Entry: 4hih, 2 Å

PDB Description: anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.

PDB Compounds: (C:) Fab 023.102

SCOPe Domain Sequences for d4hihc2:

Sequence; same for both SEQRES and ATOM records:

>d4hihc2 b.1.1.0 (C:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnr

Timeline for d4hihc2:

• d4hihc2 first appeared in SCOPe 2.03
  
• d4hihc2 appears in SCOPe 2.05
  
• d4hihc2 appears in SCOPe 2.07
  
• d4hihc2 appears in the current release, SCOPe 2.08