SCOPe 2.08: Domain d4hiha2: 4hih A:108-211

Lineage for d4hiha2 (4hih A:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4hiha2: 4hih A:108-211 [222625]
   Other proteins in same PDB: d4hihb_, d4hihd_
   automated match to d1boga2
   complexed with ram

Details for d4hiha2

PDB Entry: 4hih, 2 Å

PDB Description: anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.

PDB Compounds: (A:) Fab 023.102

SCOPe Domain Sequences for d4hiha2:

Sequence; same for both SEQRES and ATOM records:

>d4hiha2 b.1.1.0 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnr

Timeline for d4hiha2:

• d4hiha2 first appeared in SCOPe 2.03
  
• d4hiha2 appears in SCOPe 2.07