![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Drosophila mojavensis [TaxId:7230] [226516] (1 PDB entry) |
![]() | Domain d4hi7b2: 4hi7 B:88-219 [222621] Other proteins in same PDB: d4hi7a1, d4hi7a3, d4hi7b1 automated match to d1r5aa1 complexed with gsh |
PDB Entry: 4hi7 (more details), 1.25 Å
SCOPe Domain Sequences for d4hi7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hi7b2 a.45.1.0 (B:88-219) automated matches {Drosophila mojavensis [TaxId: 7230]} kdlvkralvdnrmyfesgvvfanalrslakmilflgktevpqeridaiteaydfveaffk dqtyvagnqltiadfslississlvafvpvdaakypklsawikrleqlpyyaenstgaqq fvaavkskpftv
Timeline for d4hi7b2: