Lineage for d4hi7b2 (4hi7 B:88-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713924Species Drosophila mojavensis [TaxId:7230] [226516] (1 PDB entry)
  8. 2713926Domain d4hi7b2: 4hi7 B:88-219 [222621]
    Other proteins in same PDB: d4hi7a1, d4hi7a3, d4hi7b1
    automated match to d1r5aa1
    complexed with gsh

Details for d4hi7b2

PDB Entry: 4hi7 (more details), 1.25 Å

PDB Description: crystal structure of glutathione transferase homolog from drosophilia mojavensis, target efi-501819, with bound glutathione
PDB Compounds: (B:) gi20122

SCOPe Domain Sequences for d4hi7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hi7b2 a.45.1.0 (B:88-219) automated matches {Drosophila mojavensis [TaxId: 7230]}
kdlvkralvdnrmyfesgvvfanalrslakmilflgktevpqeridaiteaydfveaffk
dqtyvagnqltiadfslississlvafvpvdaakypklsawikrleqlpyyaenstgaqq
fvaavkskpftv

SCOPe Domain Coordinates for d4hi7b2:

Click to download the PDB-style file with coordinates for d4hi7b2.
(The format of our PDB-style files is described here.)

Timeline for d4hi7b2: