SCOPe 2.08: Domain d4hi7a2: 4hi7 A:88-221

Lineage for d4hi7a2 (4hi7 A:88-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Drosophila mojavensis [TaxId:7230] [226516] (1 PDB entry)

8. Domain d4hi7a2: 4hi7 A:88-221 [222619]
   Other proteins in same PDB: d4hi7a1, d4hi7a3, d4hi7b1
   automated match to d1r5aa1
   complexed with gsh

Details for d4hi7a2

PDB Entry: 4hi7, 1.25 Å

PDB Description: crystal structure of glutathione transferase homolog from drosophilia mojavensis, target efi-501819, with bound glutathione

PDB Compounds: (A:) gi20122

SCOPe Domain Sequences for d4hi7a2:

Sequence; same for both SEQRES and ATOM records:

>d4hi7a2 a.45.1.0 (A:88-221) automated matches {Drosophila mojavensis [TaxId: 7230]}
kdlvkralvdnrmyfesgvvfanalrslakmilflgktevpqeridaiteaydfveaffk
dqtyvagnqltiadfslississlvafvpvdaakypklsawikrleqlpyyaenstgaqq
fvaavkskpftvvg

Timeline for d4hi7a2:

• d4hi7a2 first appeared in SCOPe 2.03
  
• d4hi7a2 appears in SCOPe 2.07