| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
| Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
| Protein automated matches [226964] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
| Domain d4hhzd1: 4hhz D:2-135 [222616] Other proteins in same PDB: d4hhza2, d4hhzb2, d4hhzc2, d4hhzd2 automated match to d1gs0a1 complexed with 15s, so4 |
PDB Entry: 4hhz (more details), 2.72 Å
SCOPe Domain Sequences for d4hhzd1:
Sequence, based on SEQRES records: (download)
>d4hhzd1 a.41.1.0 (D:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek
>d4hhzd1 a.41.1.0 (D:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeiklskrqiqaasnrfytliphddsvqakaeml
dnlldievaysllrgidvnyek
Timeline for d4hhzd1: