Lineage for d4hhza2 (4hhz A:136-349)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234232Domain d4hhza2: 4hhz A:136-349 [222611]
    Other proteins in same PDB: d4hhza1, d4hhzb1, d4hhzc1, d4hhzd1
    automated match to d1gs0a2
    complexed with 15s, so4

Details for d4hhza2

PDB Entry: 4hhz (more details), 2.72 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhza2 d.166.1.0 (A:136-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4hhza2:

Click to download the PDB-style file with coordinates for d4hhza2.
(The format of our PDB-style files is described here.)

Timeline for d4hhza2: