Lineage for d4hhza1 (4hhz A:1-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325454Domain d4hhza1: 4hhz A:1-135 [222610]
    Other proteins in same PDB: d4hhza2, d4hhzb2, d4hhzc2, d4hhzd2
    automated match to d1gs0a1
    complexed with 15s, so4

Details for d4hhza1

PDB Entry: 4hhz (more details), 2.72 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhza1 a.41.1.0 (A:1-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d4hhza1:

Click to download the PDB-style file with coordinates for d4hhza1.
(The format of our PDB-style files is described here.)

Timeline for d4hhza1: