Lineage for d4hhyb2 (4hhy B:136-349)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1442208Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1442209Protein automated matches [191197] (5 species)
    not a true protein
  7. 1442231Species Human (Homo sapiens) [TaxId:9606] [225406] (19 PDB entries)
  8. 1442247Domain d4hhyb2: 4hhy B:136-349 [222605]
    Other proteins in same PDB: d4hhya1, d4hhyb1, d4hhyc1, d4hhyd1
    automated match to d1gs0a2
    complexed with 15r, peg, so4

Details for d4hhyb2

PDB Entry: 4hhy (more details), 2.36 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhyb2 d.166.1.0 (B:136-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4hhyb2:

Click to download the PDB-style file with coordinates for d4hhyb2.
(The format of our PDB-style files is described here.)

Timeline for d4hhyb2: