![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
![]() | Protein automated matches [226964] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225405] (21 PDB entries) |
![]() | Domain d4hhya1: 4hhy A:1-135 [222602] Other proteins in same PDB: d4hhya2, d4hhyb2, d4hhyc2, d4hhyd2 automated match to d1gs0a1 complexed with 15r, peg, so4 |
PDB Entry: 4hhy (more details), 2.36 Å
SCOPe Domain Sequences for d4hhya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhya1 a.41.1.0 (A:1-135) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg sddsskdpidvnyek
Timeline for d4hhya1: