Lineage for d1funb_ (1fun B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658133Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)
  8. 658230Domain d1funb_: 1fun B: [22260]

Details for d1funb_

PDB Entry: 1fun (more details), 2.85 Å

PDB Description: superoxide dismutase mutant with lys 136 replaced by glu, cys 6 replaced by ala and cys 111 replaced by ser (k136e, c6a, c111s)
PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d1funb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1funb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestetgnagsrlacgvigiaq

SCOP Domain Coordinates for d1funb_:

Click to download the PDB-style file with coordinates for d1funb_.
(The format of our PDB-style files is described here.)

Timeline for d1funb_: