![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries) |
![]() | Domain d4hgrd_: 4hgr D: [222593] automated match to d3nrjl_ complexed with mg; mutant |
PDB Entry: 4hgr (more details), 2.05 Å
SCOPe Domain Sequences for d4hgrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgrd_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgakteiv rrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa sapfyirrlstiflekrggegvfrefvekvlginledfiaviq
Timeline for d4hgrd_: