| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (43 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries) |
| Domain d4hgoa_: 4hgo A: [222578] automated match to d3nrjl_ complexed with kdn, mg, vn4 |
PDB Entry: 4hgo (more details), 2.1 Å
SCOPe Domain Sequences for d4hgoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgoa_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiavi
Timeline for d4hgoa_: