![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries) |
![]() | Domain d4hgnd1: 4hgn D:3-166 [222577] Other proteins in same PDB: d4hgna2, d4hgnb2, d4hgnc2, d4hgnd2 automated match to d3nrjl_ complexed with fmt, mg |
PDB Entry: 4hgn (more details), 1.8 Å
SCOPe Domain Sequences for d4hgnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgnd1 c.108.1.0 (D:3-166) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} tinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiitg grteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrecg lpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm
Timeline for d4hgnd1: