SCOPe 2.08: Domain d4hgnc1: 4hgn C:3-166

Lineage for d4hgnc1 (4hgn C:3-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries)

8. Domain d4hgnc1: 4hgn C:3-166 [222576]
   Other proteins in same PDB: d4hgna2, d4hgnb2, d4hgnc2, d4hgnd2
   automated match to d3nrjl_
   complexed with fmt, mg

Details for d4hgnc1

PDB Entry: 4hgn, 1.8 Å

PDB Description: crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from bacteroides thetaiotaomicron

PDB Compounds: (C:) 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase

SCOPe Domain Sequences for d4hgnc1:

Sequence; same for both SEQRES and ATOM records:

>d4hgnc1 c.108.1.0 (C:3-166) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
tinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiitg
grteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrecg
lpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm

Timeline for d4hgnc1:

• d4hgnc1 first appeared in SCOPe 2.03, called d4hgnc_
  
• d4hgnc1 was called d4hgnc_ in SCOPe 2.07