Lineage for d4hgnb_ (4hgn B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629242Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries)
  8. 1629244Domain d4hgnb_: 4hgn B: [222575]
    automated match to d3nrjl_
    complexed with fmt, mg

Details for d4hgnb_

PDB Entry: 4hgn (more details), 1.8 Å

PDB Description: crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from bacteroides thetaiotaomicron
PDB Compounds: (B:) 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase

SCOPe Domain Sequences for d4hgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgnb_ c.108.1.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkw

SCOPe Domain Coordinates for d4hgnb_:

Click to download the PDB-style file with coordinates for d4hgnb_.
(The format of our PDB-style files is described here.)

Timeline for d4hgnb_: