SCOPe 2.07: Domain d4hgna_: 4hgn A:

Lineage for d4hgna_ (4hgn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (53 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries)

8. Domain d4hgna_: 4hgn A: [222574]
   automated match to d3nrjl_
   complexed with fmt, mg

Details for d4hgna_

PDB Entry: 4hgn, 1.8 Å

PDB Description: crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from bacteroides thetaiotaomicron

PDB Compounds: (A:) 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase

SCOPe Domain Sequences for d4hgna_:

Sequence; same for both SEQRES and ATOM records:

>d4hgna_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm

Timeline for d4hgna_:

• d4hgna_ first appeared in SCOPe 2.03
  
• d4hgna_ appears in SCOPe 2.06