Lineage for d4hgmb1 (4hgm B:4-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2009791Family a.126.1.1: Serum albumin-like [48553] (2 protein domains)
  6. 2009792Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2009793Species Human (Homo sapiens) [TaxId:9606] [48555] (77 PDB entries)
    Uniprot P02768 29-596
  8. 2009821Domain d4hgmb1: 4hgm B:4-196 [222572]
    Other proteins in same PDB: d4hgma_
    automated match to d1n5ua1
    complexed with ace, edo

Details for d4hgmb1

PDB Entry: 4hgm (more details), 2.34 Å

PDB Description: Shark IgNAR Variable Domain
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4hgmb1:

Sequence, based on SEQRES records: (download)

>d4hgmb1 a.126.1.1 (B:4-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d4hgmb1 a.126.1.1 (B:4-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvaemadccakqepernecflqhkddnpnlprlvrpevdvmctafhdn
eetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegk
assakq

SCOPe Domain Coordinates for d4hgmb1:

Click to download the PDB-style file with coordinates for d4hgmb1.
(The format of our PDB-style files is described here.)

Timeline for d4hgmb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4hgma_