Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Dogfish (Squalus acanthias) [TaxId:7797] [226656] (2 PDB entries) |
Domain d4hgma_: 4hgm A: [222571] Other proteins in same PDB: d4hgmb1, d4hgmb2, d4hgmb3 automated match to d1fgvl_ complexed with ace, edo |
PDB Entry: 4hgm (more details), 2.34 Å
SCOPe Domain Sequences for d4hgma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgma_ b.1.1.1 (A:) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]} trvdqspsslsasvgdrvtitcvltdtsyplystywyqqkpgssnkeqisisgrysesvn kgtksftltisslqpedfatyycramgtniwtgdgagtkveik
Timeline for d4hgma_: