Lineage for d4hgib_ (4hgi B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005036Domain d4hgib_: 4hgi B: [222568]
    automated match to d4hgha_
    complexed with gol, hem, mes, peg, syn

Details for d4hgib_

PDB Entry: 4hgi (more details), 1.5 Å

PDB Description: Crystal structure of P450 BM3 5F5 heme domain variant complexed with styrene (dataset II)
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4hgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglatswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllahmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d4hgib_:

Click to download the PDB-style file with coordinates for d4hgib_.
(The format of our PDB-style files is described here.)

Timeline for d4hgib_: