Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d4hfwa1: 4hfw A:2-106 [222560] Other proteins in same PDB: d4hfwa2, d4hfwl2 automated match to d1rhha1 complexed with so4 |
PDB Entry: 4hfw (more details), 2.6 Å
SCOPe Domain Sequences for d4hfwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hfwa1 b.1.1.0 (A:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} irltqspsslsasvgdrvtitcrasqsisnylnwyqkkpgqapklliyaatslqsgvpsr fsgsgsgtdftltissvqpedfatyycqktlrtwtfgqgtkveik
Timeline for d4hfwa1: