SCOPe 2.08: Domain d4heib_: 4hei B:

Lineage for d4heib_ (4hei B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
   beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest

4. Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families)
   automatically mapped to Pfam PF02482

5. Family d.204.1.0: automated matches [227270] (1 protein)
   not a true family

6. Protein automated matches [227070] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226508] (1 PDB entry)

8. Domain d4heib_: 4hei B: [222554]
   automated match to d2ywqa1
   complexed with 3co, scn, unl

Details for d4heib_

PDB Entry: 4hei, 1.6 Å

PDB Description: 2a x-ray structure of hpf from vibrio cholerae

PDB Compounds: (B:) Ribosome hibernation protein YhbH

SCOPe Domain Sequences for d4heib_:

Sequence; same for both SEQRES and ATOM records:

>d4heib_ d.204.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mqiniqghhidltdsmqdyvhskfdklerffdhinhvqvilrveklrqiaeatlhvnqae
ihahaddenmyaaidslvdklvrqlnkhkek

Timeline for d4heib_:

• d4heib_ first appeared in SCOPe 2.03
  
• d4heib_ appears in SCOPe 2.07