Lineage for d4he4b_ (4he4 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408153Species Phialidium sp. [TaxId:258839] [226678] (1 PDB entry)
  8. 1408155Domain d4he4b_: 4he4 B: [222546]
    automated match to d2hpwa_

Details for d4he4b_

PDB Entry: 4he4 (more details), 2.05 Å

PDB Description: Crystal structure of the yellow fluorescent protein phiYFP (Phialidium sp.)
PDB Compounds: (B:) yellow fluorescent protein

SCOPe Domain Sequences for d4he4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4he4b_ d.22.1.0 (B:) automated matches {Phialidium sp. [TaxId: 258839]}
gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktyd

SCOPe Domain Coordinates for d4he4b_:

Click to download the PDB-style file with coordinates for d4he4b_.
(The format of our PDB-style files is described here.)

Timeline for d4he4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4he4a_