SCOPe 2.05: Domain d4he4a_: 4he4 A:

Lineage for d4he4a_ (4he4 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Phialidium sp. [TaxId:258839] [226678] (1 PDB entry)

8. Domain d4he4a_: 4he4 A: [222545]
   automated match to d2hpwa_

Details for d4he4a_

PDB Entry: 4he4, 2.05 Å

PDB Description: Crystal structure of the yellow fluorescent protein phiYFP (Phialidium sp.)

PDB Compounds: (A:) yellow fluorescent protein

SCOPe Domain Sequences for d4he4a_:

Sequence; same for both SEQRES and ATOM records:

>d4he4a_ d.22.1.0 (A:) automated matches {Phialidium sp. [TaxId: 258839]}
gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktyd

Timeline for d4he4a_:

• d4he4a_ first appeared in SCOPe 2.03
  
• d4he4a_ appears in SCOPe 2.04
  
• d4he4a_ is called d4he4a1 in SCOPe 2.06
  
• d4he4a_ appears in the current release, SCOPe 2.08, called d4he4a1